PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_41934
Common NameKK1_042797
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family STAT
Protein Properties Length: 708aa    MW: 79142.4 Da    PI: 4.9829
Description STAT family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_41934genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1STAT198.75.4e-622223431122
           STAT   1 ldvvllnalgqpvekdvevvasLlyadsglvveksddaeapLLisydGvefssedrplkllrGrasfklkisqLsskcdnrLfrikfeipklkkyp 96 
                    ldvvl++a+gqpv+k+ ev asLlyad+g++ve++ d+eapLL++ydG+efss +rp+kll GrasfklkisqLsskcdnrLf i+f++pkl +yp
  C.cajan_41934 222 LDVVLSDAFGQPVDKENEVFASLLYADTGAPVENTTDNEAPLLATYDGIEFSSCERPSKLLLGRASFKLKISQLSSKCDNRLFLIRFCVPKLGNYP 317
                    8*********************************************************************************************** PP

           STAT  97 fleavskpirCisrsrntrsssltkk 122
                    fle++s+pirCisrsrntr s+l++k
  C.cajan_41934 318 FLETYSRPIRCISRSRNTRLSTLVWK 343
                    *******************9999886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF498998.31E-825174IPR013320Concanavalin A-like lectin/glucanase domain
Gene3DG3DSA:3.30.505.103.4E-7607681IPR000980SH2 domain
SuperFamilySSF555501.04E-8609698IPR000980SH2 domain
PROSITE profilePS500019.915615697IPR000980SH2 domain
Sequence ? help Back to Top
Protein Sequence    Length: 708 aa     Download sequence    Send to blast
MGTDAVGSEG YSLLKDLRLD IEVKDATFSL CFWLYFTDSA TFPVTIIQQV YSDISESAPF  60
LVINDNKRII MLPVLLLHEE APDTGNINSW EEVPHATVDF EFPLEKWVHV GCEVCPDRIQ  120
LQINGEIVGE KSLCSLLNKE SISSDLKKLT LANVGGDGNS VQGYVHNFEI FPIVSSLKDR  180
HLKDPPLKLS IDESSASEIE EESDGVCGIV GGKASCRRNF SLDVVLSDAF GQPVDKENEV  240
FASLLYADTG APVENTTDNE APLLATYDGI EFSSCERPSK LLLGRASFKL KISQLSSKCD  300
NRLFLIRFCV PKLGNYPFLE TYSRPIRCIS RSRNTRLSTL VWKRSTSALN CPSLSQSSAM  360
EDGSLELQHS CHEAQANPLL KRFRLGQDKI SVSVKADPNL EQPDEECNSH VRTANQVENG  420
FPTSFDGRPA NFNEADGTPS DSESIGEGNS PLNNMGSRRY PISDMTIFKY CLASLVERSL  480
MLKEIATTAS DKEISELAHH VSLYSGCSHH GNQILMAKRL IKDGTSLWNR ISPNNHHIPW  540
ESAVFEIEEQ FMKIASCGSR PLSPQDLDLL RRIAGCQEYL TQENFEKLWC WLYPVAFIIS  600
RDWINPIWNS TSPKWIEGFI TKEEAEASLQ GPTGFQEPGT FILRFPTSRS WPHPDAGSLV  660
VTYVSNEYKL HHRLLSMDHV YGSGDKRVDV KPLQDMLLAE PELSRLGR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150391e-131AP015039.1 Vigna angularis var. angularis DNA, chromosome 6, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006597985.10.0PREDICTED: uncharacterized protein LOC100803169 isoform X1
TrEMBLA0A151R0T30.0A0A151R0T3_CAJCA; Uncharacterized protein
STRINGGLYMA15G27760.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF67103036
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G78540.10.0SH2 domain protein B